Dataset for protein Unclassified of organism Nothobranchius furzeri

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A1A8AM77_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Nothobranchius furzeri (length=223 residues).
MANEWNRNIVENYICHKLSKRGFAWGFDDGAVANNGSVGDRSPTVVRRCREAGSPGPDVDCRRISQQPEPLADIHRVMRE
AGDELERLYQLDFTEMSRQLYLTNATAKTRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECASREEMATQVDTIAEWMT
EYLNGPLLNSWIEDNGGWGAFVDLYDRQKDSVFSCYWPSIKTVFGLAALGAASITIGAYLAQK
© 1998-2021Legal notice