Dataset for protein Mcl-1 of organism Nothobranchius furzeri

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A1A8A7I9_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Nothobranchius furzeri GN=MCL-1 (length=290 residues).
MLQRKTPSSVFGCLFSQNGVVDGPLHYGPGDSPPHIATGATLDSANGNVESGDGPKRPSNLEVSPHNGFAAKRFSHEEED
GSLPCTPEFHAGSETEVPSGHAGDEALANDTRQLINRFFMEFTGQLKPQWRDSRELSTMKRVVNDILEKHRYAYKGMAAK
CTSDDLTFISKVAENMFSDGITNWGRIVSLLAFGAVVAQYQKDNGRQNNVELVSHEVSTYLLSQQRDFLLRNNSWQGFVE
FFRVTDPESTVRNTLMAIAGVAGMGATLALLISCCRHDTSFQTVPSIPSY
>gnl|bcl2dbpro|A0A1A8A7I9_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Nothobranchius furzeri GN=MCL-1 (length=273 residues).
MLQRKTPSSVFGCLFSQNGVVDGPLHYGPGDSPPHIATGATLDSANGNVESGDGPKRPSNLEVSPHNGFAAKRFSHEEED
GSLPCTPEFHAGSETEVPSGHAGDEALANDTRQLINRFFMEFTGQLKPQWRDSRELSTMKRVVNDILEKHRYAYKGMAAK
CTSDDLTFISKVAENMFSDGITNWGRIVSLLAFGAVVAQYQKDNGRQNNVELVSHEVSTYLLSQQRDFLLRNNSWQGFVE
FFRVTDPESTVRNTLMAIAGVAGMGATLALLIR
>gnl|bcl2dbpro|A0A1A8A7I9_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Nothobranchius furzeri GN=MCL-1 (length=273 residues).
MLQRKTPSSVFGCLFSQNGVVDGPLHYGPGDSPPHIATGATLDSANGNVESGDGPKRPSNLEVSPHNGFAAKRFSHEEED
GSLPCTPEFHAGSETEVPSGHAGDEALANDTRQLINRFFMEFTGQLKPQWRDSRELSTMKRVVNDILEKHRYAYKGMAAK
CTSDDLTFISKVAENMFSDGITNWGRIVSLLAFGAVVAQYQKDNGRQNNVELVSHEVSTYLLSQQRDFLLRNNSWQGFVE
FFRVTDPESTVRNTLMAIAGVAGMGATLALLIR
© 1998-2021Legal notice