Dataset for protein Bcl-2 of organism Neovison vison

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C7B9K2_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Neovison vison GN=BCL-2 (length=234 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAAPPGAAPAPGIFSSQPGRTPAPARTSPPPPPAALAAAAAAGPA
LSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE
MSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSVQPLFDFSWLSLKALLSLALVGACITLGAYLGHK
© 1998-2022Legal notice