Dataset for protein Bcl2l10 of organism Neogobius melanostomus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C6UWE4_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Neogobius melanostomus GN=BCL2L10 (length=187 residues).
MSCGLWKETLALAEDYLCLCCSPQAARPPPSGSAAAMRRLGQDMEAQHKARFHTLSQTFLKQCGPDPCSSLRKVMEELVG
DGLLNWGRVVSLFTFAGVLARQIQEQKCSRSGQDPGKVPADCRLLAETIADYLGEEKRDWLLDNGGWVGFCEFSCHSRKV
DQDSSMKTALFAAAGVGLAGLTFLLVR
© 1998-2022Legal notice