Dataset for protein Unclassified of organism Nasonia vitripennis

[Download (right click)]

2 sequence(s)

>gnl|bcl2dbpro|A0A7M7Q2A7_uncBCL2L1-02 Putative BCL2-like 1 protein OS=[Eukaryota] Nasonia vitripennis (length=296 residues).
MAGERAANNAEGRSGGGSGARTGPTMVEGLVAVARGEPHSRVGGILECDPAAAAAAAAAAPGNSTGKSTDEQQEQQPAAA
VVDGLCRYAAGATSGGMSFVEVCQIRLQQLFPQLTPPPRSSLCEDSIELTAECLANDVIRYLLKEDIYMISRDPISRSMR
HNVYQMLNKHSILFTSMVNRLNVVPDTAYEAFMGVADELFHQGITWARIVCLYAFMGRLALWARDRRMHSLKQKLPMYVS
RYIGEEIAQFIKICGGWEQLCIEYPVAEEVSGAVWRSLLMTGATLGLVATILSVTS
>gnl|bcl2dbpro|A0A7M7Q2A7_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Nasonia vitripennis (length=296 residues).
MAGERAANNAEGRSGGGSGARTGPTMVEGLVAVARGEPHSRVGGILECDPAAAAAAAAAAPGNSTGKSTDEQQEQQPAAA
VVDGLCRYAAGATSGGMSFVEVCQIRLQQLFPQLTPPPRSSLCEDSIELTAECLANDVIRYLLKEDIYMISRDPISRSMR
HNVYQMLNKHSILFTSMVNRLNVVPDTAYEAFMGVADELFHQGITWARIVCLYAFMGRLALWARDRRMHSLKQKLPMYVS
RYIGEEIAQFIKICGGWEQLCIEYPVAEEVSGAVWRSLLMTGATLGLVATILSVTS
© 1998-2021Legal notice