Dataset for protein Bcl2l10 of organism Nannospalax galili

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C6WBP6_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Nannospalax galili GN=BCL2L10 (length=183 residues).
MADPLRERTRQLLIDYLLFCAREPGTRELPPSSSEAAVLRSVAAQTLQLHQPFFSSFRGYQGNSLELLSQMADVVLSDQQ
SLNWGRVVVLVAFAGMLLDQSPCKNTKGRNRLHVLRDCLYMVDLLCTRLTGRHRAWLEAQDDWDGFCRFFRRPFPLSFWR
RLLLQMFLSCFFAIGILYLWKRL
© 1998-2022Legal notice