Dataset for protein Unclassified of organism Myripristis murdjan

[Download (right click)]

9 sequence(s)

>gnl|bcl2dbpro|A0A667WIR5_uncBCL2L10-01 Putative BCL2-like 10 protein OS=[Eukaryota] Myripristis murdjan (length=207 residues).
MRREQSDIAGRKMSCWLWKETLALAEDYLFFCSISTQPAPPPPSESAAAMRRLAQDMETQHHARFHSLAQTFLQQCGQDP
CSSLRKVMEELVGDGQLNWGRVVSLFTFTGVLARQLREQDGTKPGLDPGQGQDLGQGPSSCRGLAETIADYLGEEKKDWM
LENDSWEGFCKFSRSAREVNQDSSMKTALFAAAGVGIAGLTFLLGCD
>gnl|bcl2dbpro|A0A667WZK8_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Myripristis murdjan (length=222 residues).
MADRAAAYDSRHIVENYLRHKLLKKGVAWPLHLPPRSPPAASSSSSSSSSSSPLSGEGVRTSRRGATPSPEGEEEEPPRA
APHVARLQDVLQQAGDELEQRYHGDFNAQMCALLDAVRDELLGDGVNWGRVVVLLELGGALCVEAARRRWAGHVDDIASW
MVESLEAPPLRGWIENNGGWDAFVDLYGQAGPAGRSWSLRTLVGLAALGAAGITLGALFTQK
>gnl|bcl2dbpro|A0A667Z8D3_uncBCL2-05 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Myripristis murdjan (length=294 residues).
AHLFGIGKCIAMECYKQGAFITLVARDEAKLLQAKKEVEKCAINDKQVVLCISVDVSKDYGQVESVIKQAQEKLGPVDML
VNCAGMSISGKFEEVEVDRFKRLMEVNYLGSVYPTRAVITTMKERRMGRIMFVSSQAGQIGLFGYTAYSPSKFALRGLAE
SLQMEMKPYNIYVTVAYPPDTDTPGLAEENKTKPLETKLISETSGVCQPEQVAKIVVRDAVQGNFNSSVGPDGYMLSALT
CGMSPVTSITEGLQQIVTMGLFRTIALFYLGSFDSIVRRCMIQREQSKAADKRE
>gnl|bcl2dbpro|A0A667Z8D3_uncBCL2-06 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Myripristis murdjan (length=297 residues).
MLLVVAAFIVAFVLLLYMISPLISPKPLKLNGAHVVVTGGSSGIGKCIAMECYKQGAFITLVARDEAKLLQAKKEVEKCA
INDKQVVLCISVDVSKDYGQVESVIKQAQEKLGPVDMLVNCAGMSISGKFEEVEVDRFKRLMEVNYLGSVYPTRAVITTM
KERRMGRIMFVSSQAGQIGLFGYTAYSPSKFALRGLAESLQMEMKPYNIYVTVAYPPDTDTPGLAEENKTKPLETKLISE
TSGVCQPEQVAKIVVRDAIVTMGLFRTIALFYLGSFDSIVRRCMIQREQSKAADKRE
>gnl|bcl2dbpro|A0A667Z8D3_uncBCL2-07 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Myripristis murdjan (length=186 residues).
MSSEEGLSSTITDWLFINSWWLLLPFIMLLVVAAFIVAFVLLLYMISPLISPKPLKLNGAHVVVTGGSSGIGKCIAMECY
KQGAFITLVARDEVVLCISVDVSKDYGQVESVIKQAQEKLGPVDMLVNCAGMSISGKFEEVEVDRFKIVTMGLFRTIALF
YLGSFDSIVRRCMIQREQSKAADKRE
>gnl|bcl2dbpro|A0A667Z8D3_uncBCL2-04 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Myripristis murdjan (length=351 residues).
MSSEEGLSSTITDWLFINSWWLLLPFIMLLVVAAFIVAFVLLLYMISPLISPKPLKLNGAHVVVTGGSSGIGKCIAMECY
KQGAFITLVARDEVSRNAHSDSQPVVLCISVDVSKDYGQVESVIKQAQEKLGPVDMLVNCAGMSISGKFEEVEVDRFKRL
MEVNYLGSVYPTRAVITTMKERRMGRIMFVSSQAGQIGLFGYTAYSPSKFALRGLAESLQMEMKPYNIYVTVAYPPDTDT
PGLAEENKTKPLETKLISETSGVCQPEQVAKIVVRDAVQGNFNSSVGPDGYMLSALTCGMSPVTSITEGLQQIVTMGLFR
TIALFYLGSFDSIVRRCMIQREQSKAADKRE
>gnl|bcl2dbpro|A0A667Z8D3_uncBCL2-03 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Myripristis murdjan (length=359 residues).
MSSEEGLSSTITDWLFINSWWLLLPFIMLLVVAAFIVAFVLLLYMISPLISPKPLKLNGAHVVVTGGSSGIGKCIAMECY
KQGAFITLVARDEAKLLQAKKEVEKCAINDKQVVLCISVDVSKDYGQVESVIKQAQEKLGPVDMLVNCAGMSISGKFEEV
EVDRFKRLMEVNYLGSVYPTRAVITTMKERRMGRIMFVSSQAGQIGLFGYTAYSPSKFALRGLAESLQMEMKPYNIYVTV
AYPPDTDTPGLAEENKTKPLETKLISETSGVCQPEQVAKIVVRDAVQGNFNSSVGPDGYMLSALTCGMSPVTSITEGLQQ
IVTMGLFRTIALFYLGSFDSIVRRCMIQREQSKAADKRE
>gnl|bcl2dbpro|A0A667Z8D3_uncBCL2-02 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Myripristis murdjan (length=338 residues).
MLLVVAAFIVAFVLLLYMISPLISPKPLKLNGAHVVVTGGSSGIGKCIAMECYKQGAFITLVARDEAKLLQAKKEVEKCA
INDKQVVLCISVDVSKDYGQVESVIKQAQEKLGPVDMLVNCAGMSISGKFEEVEVDRFKRLMEVNYLGSVYPTRAVITTM
KERRMGRIMFVSSQAGQIGLFGYTAYSPSKFALRGLAESLQMEMKPYNIYVTVAYPPDTDTPGLAEENKTKPLETKLISE
TSGVCQPEQVAKIVVRDAVQGNFNSSVGPDGYMLSALTCGMSPVTSITEGLQQDAFVELYDRQRDSVFSCSWPSIKTVFG
LAALGAASLTIGAYLTQK
>gnl|bcl2dbpro|A0A667Z8D3_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Myripristis murdjan (length=228 residues).
MANECNRNIVEKYISHKLSKRGIVWEFDDVREEDAANNGSVVAPPPTLVRRCRGASAGPETESIPQLSKRLSQSDPHAAI
HRVLREAGDELERLYQPDFTEMSHQLYLTTTTAQRRFTEVIDELFRDGVNWGRIIAFFEFGGTVCVECAGKEEMTSQVDH
IAEWMTEYLNGPLNSWIQDNGGWDAFVELYDRQRDSVFSCSWPSIKTVFGLAALGAASLTIGAYLTQK
© 1998-2020Legal notice