Dataset for protein Unclassified of organism Mus musculus

[Download (right click)]

4 sequence(s)

>gnl|bcl2dbpro|G3XA70_uncBCL2L2-01 Putative BCL2-like 2 protein OS=[Eukaryota] Mus musculus (length=193 residues).
MATPASTPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQDWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|G3XA70_uncBCL2L2-02 Putative BCL2-like 2 protein OS=[Eukaryota] Mus musculus (length=79 residues).
MEPLVGQVQDWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|G3XA70_uncBCL2L2-03 Putative BCL2-like 2 protein OS=[Eukaryota] Mus musculus (length=178 residues).
MATPASTPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQDWMVAYLETRLADWIHSSGGWVRSSQLLLSASLYKVG
LHGKIGPLMGGWGCAGKG
>gnl|bcl2dbpro|G3XA70_uncBCL2L2-04 Putative BCL2-like 2 protein OS=[Eukaryota] Mus musculus (length=117 residues).
MATPASTPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEP
© 1998-2023Legal notice