Dataset for protein Bcl-2 of organism Mus musculus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|P10417_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Mus musculus GN=BCL-2 (length=236 residues).
MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPAVHRDMAARTSPLRPLVATAG
PALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVN
REMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
© 1998-2020Legal notice