Dataset for protein Unclassified of organism Moschus moschiferus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C6FIZ6_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Moschus moschiferus (length=155 residues).
MSQSNWELVVDFLSYKLSQKGYSWSQFSDMKENRTETPEGIESTMENSRAINGNPSWHLADSPAVNGATDHSTRLDAQKM
IPMTTVKQALNEARNEFELKYQQTFSDLMSQLHITPGTTYQSFEQNGGWDTFGNSTKTEQQPRAKRAKSASAAGP
© 1998-2022Legal notice