Dataset for protein Bcl-xL of organism Miichthys miiuy

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8F0MQ26_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Miichthys miiuy GN=BCL2L1 (length=232 residues).
MTQNRELVIFYINYKLSQRNYPLNYMGLREPPNRTDEGEAGVGEEQRVATHANGTFNGTSPGTPPGSPPRQQQPASATSM
DAVKEALRESANEFELRYARAFNDLHNQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPLV
SRIIEWMTVYLDIRIQPWIQSQGGWERFAEIFGQDAAAEGRRSQESFKKWLLAGMTLVTGVVVGSLIAQKRL
© 1998-2022Legal notice