Dataset for protein Bfl1 of organism Marmota marmota marmota

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C5YJP3_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Marmota marmota marmota GN=BCL2A1 (length=175 residues).
MNDCEFRFIHMLAQDYLQHVLQVPQRGSSPNKTSKVLQNVAFSVQKEVEKNLKPYLDNFDVVSADTARTIFNQVMEKEFE
DGIMNWGRIVTIFAFGGVLVKKLLRERIAPAVDSDVEISYFVAEFIMNNAGEWIRQNGGWENGFVKKFEPKSGWLTFLGV
TGQICEMLSLLKQYY
© 1998-2022Legal notice