Dataset for protein Bcl-2 of organism Marmota marmota marmota

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C5YTS1_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Marmota marmota marmota GN=BCL-2 (length=228 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAASPGAAPGPGIFSSQPGXXPAARTSPPRPPAAAAGPVLSPVPP
VVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVD
NIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSVRPLYDFSWLSLKTLLSLALVGACITLGAYLGHK
© 1998-2022Legal notice