Dataset for protein Bfl1 of organism Malurus cyaneus samueli

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C5X4L3_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Malurus cyaneus samueli GN=BCL2A1 (length=174 residues).
METAEFYYVYYLAQDYLQYVLQESHLAPAQTRVAHVLRSIASSLQEQTEEALRPLLDTIDITSVAAAKRIFNGVMEEKFA
DGNTNWGRIMTIFTFGGLLTKKLQEHGVQLTAEEKEEISYFITEYIINNKAEWIDANGGWENGFLTKFERRSLLSFSKIT
ALFIAVVSLFREYY
© 1998-2022Legal notice