Dataset for protein Bcl-2 of organism Macaca mulatta

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A5F7ZZ15_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Macaca mulatta GN=BCL-2 (length=241 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAATPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLPTPAAPAA
AAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMC
VESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGH
K
© 1998-2020Legal notice