Dataset for protein Unclassified of organism Macaca fascicularis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A2K5WP17_uncBCL2A1-01 Putative BCL2-related protein A1 protein OS=[Eukaryota] Macaca fascicularis (length=76 residues).
TAQSRLTATSVSQVQENGFVKKLEPKSGWMTFLEVTGKICETLFAILLTRKDTPYCETGLIFLTLKKTIANTYFYF
© 1998-2021Legal notice