Dataset for protein Bcl-2 of organism Lynx canadensis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A667GHH0_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Lynx canadensis GN=BCL-2 (length=231 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAAPGAAPAPGIFSSQPGRTPAPARTSPPPPPVAPAAAAGPALSP
VPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSP
LVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMQPLFDFSWLSLKALLSLALVGACITLGAYLGHK
© 1998-2020Legal notice