Dataset for protein Unclassified of organism Loxodonta africana

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|G3U726_uncBCL2L10-01 Putative BCL2-like 10 protein OS=[Eukaryota] Loxodonta africana (length=45 residues).
LLLTNYLKHCAREPGTPTLEPPKMTVLHHTVDYLKQHYWSFFSSY
© 1998-2020Legal notice