Dataset for protein Unclassified of organism Leptobrachium leishanense

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C5PZP2_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Leptobrachium leishanense (length=168 residues).
MLLLSFFRVFADGEEVGSVNDLFQLARPNTTLQILLRVARDTIESNHECFYNALDRLDIERPEHLHKLSRVTFELFGDGV
TNWGRVATLLSFCALVARHLKNLGMDDSIFMMADGIARFLTVTKRYWFLENRGWDGFVAVYSVRWLQIRVGLLTMAWILG
CRAGLGRN
© 1998-2022Legal notice