Dataset for protein Bcl-w of organism Leptobrachium leishanense

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C5PJB3_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Leptobrachium leishanense GN=BCL2L2 (length=191 residues).
PGLPRASDLGSRPLVEDFVRYKLHQRGLVSEPVGAPSCALHSAMRAAGDEFEDRFRQAFSEISTQIHVTPGTAYARFAEV
AGGLFQGGVNWGRVVAFFVFGAALCAESVNKEMARLLPQIQEWMVTYLETHLRDWMQSNGGWNGFLALYGDGAIEEARRQ
REGNWASLKTVLTGAVALGALMTVGALFASK
© 1998-2022Legal notice