Dataset for protein Unclassified of organism Lates calcarifer

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A4W6E8W8_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Lates calcarifer (length=192 residues).
LQGAMATAYTSRDLVEDYLRYKLLSRGVAWRFPPPPPSPPRQRNQVSSSSSSSPSRRSGTSHRDVQPDPCLAPPRVQVAL
RRAGDKLERRYRGNLSAHASALLLRADDGGRAALRRSLAVVREELFRDGVNWGRIVAMMELGGALSAEAGGAGQVDDIAR
WMEESLDSAPLQGWIEDNGGWVGRQQKCLLQV
© 1998-2020Legal notice