Dataset for protein Bcl-2 of organism Lates calcarifer

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A4W6DDI0_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Lates calcarifer GN=BCL-2 (length=229 residues).
MASECNRNIVEKYICHKLSKRGYVWRCDNVRDEDAANNGSIVSPPPTLVHRCREASGPDDNESVPNLRRRLNPQPDPYAA
IHRVLREAGDELERLYQPDFTEMSRQLYLTSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECAAKEDMTSQVD
NIAEWMTEYLNGPLNSWIKDNGGWDAFVELYDRQRESVFSCSWPSIKTVFGLAALGAASLTIGAYLTQK
© 1998-2020Legal notice