Dataset for protein Bcl-xL of organism Junco hyemalis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C5JFI3_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Junco hyemalis GN=BCL2L1 (length=336 residues).
MYSSNRELVIDFVSYKLSQKGYSWSQLEEEDENRTDFAGEEDEMDGVLNGSPSWHAATSHIVNGATVHQSSLEVHEIRRA
ADVRQALREAGDEFELRYRRAFSDLTSQLHITPSTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVVKEMRVLV
KRIVSWMTTYLTDHLDPWIQENGGWERFVDLYGNDAAAEMRKGQETFNKWLLTGATVAEANAALQPPAPSAGEIQAAGGG
RRLEGVPALQGSPNNLEENKQTYFCMCECVRVCRCVTNIKVPQPEQGSGSVPPSLAHTGTRERQELPCSIPILSLLLQSE
LIPEAGGGRGGGRGQR
© 1998-2022Legal notice