Dataset for protein Unclassified of organism Jaculus jaculus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C5L8G9_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Jaculus jaculus (length=201 residues).
MSQSNRELVVNFLSYKLSQKGYRWSQFSDVEEDRTEALEGTESETETPDSLAVNGATGHSSSLAAREATPWAAGDAFELR
GDATSQLHVTPGTACQRVAQVVKELFQDGENWGGIVAFFSFGGALCVESEDQEMQVLVSRIAGWMGTYLNAHLEPRVQEN
GLYGNNAAAESRKGPQRLNRCFLTGMAVARVVLPGSLFSGK
© 1998-2022Legal notice