Dataset for protein Bfl1 of organism Jaculus jaculus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C5L8K1_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Jaculus jaculus GN=BCL2A1 (length=173 residues).
MTDCEFAYVHSLAQDYLQCVWQEPSLCPAPSKASRLLQKVAFSAQKEVEKNLKPYLENFEVTSIDDARIIFNQVMEKEFE
DGIINWGRIVTIFAFGGVLLKKLPRQQTDLDVDTNEQISSFVAEFITNNTGEWIRQNGGWENGFIKKFEPTSGWLVLLDV
AGHIWEMLFYLKQ
© 1998-2022Legal notice