Dataset for protein Unclassified of organism Ictalurus punctatus

[Download (right click)]

7 sequence(s)

>gnl|bcl2dbpro|A0A2D0PSX4_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Ictalurus punctatus (length=204 residues).
MANQSPYDNRDIVEKYLYHKLLKRGYVWEFRAGAEEGDGLREPPAEVVDRRPRAVLPLHRVLREAGDEIERTYQRDFAAM
SDQLHFTPSTAQRRFTAVIEELFRDGVNWGRIVVFFEFGSTLCVESVNQEMASQVDNIASWMTDYLNGPLQNWIRDNGGW
DAFVELYSHQRASMFHPWPYLKTVFGLAALGAAGVTIGALFSQK
>gnl|bcl2dbpro|A0A2D0QV33_uncMCL1-03 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Ictalurus punctatus (length=178 residues).
MSCWLRKETLMLAEDYIDFCIGNQQMPPSKSAEAMRRVAKDLELQYKTKFLSMSRTFLAACGLKSDRSTCLRSVMTLLVE
DGKLNWGRIVSLFAFTGVVATEMSSRGDGVENCRKLAETIADYLVKERSDWLLENGGWDGFCRFFSSTDHVSYDSSMKTA
LFAAAGVGLAGLTFLLVR
>gnl|bcl2dbpro|A0A2D0QV33_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Ictalurus punctatus (length=178 residues).
MSCWLRKETLMLAEDYIDFCIGNQQMPPSKSAEAMRRVAKDLELQYKTKFLSMSRTFLAACGLKSDRSTCLRSVMTLLVE
DGKLNWGRIVSLFAFTGVVATEMSSRGDGVENCRKLAETIADYLVKERSDWLLENGGWDGFCRFFSSTDHVSYDSSMKTA
LFAAAGVGLAGLTFLLVR
>gnl|bcl2dbpro|A0A2D0QV33_uncMCL1-02 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Ictalurus punctatus (length=178 residues).
MSCWLRKETLMLAEDYIDFCIGNQQMPPSKSAEAMRRVAKDLELQYKTKFLSMSRTFLAACGLKSDRSTCLRSVMTLLVE
DGKLNWGRIVSLFAFTGVVATEMSSRGDGVENCRKLAETIADYLVKERSDWLLENGGWDGFCRFFSSTDHVSYDSSMKTA
LFAAAGVGLAGLTFLLVR
>gnl|bcl2dbpro|A0A2D0REW4_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Ictalurus punctatus (length=178 residues).
MACWLRKETLMLAEDYIDFCIGNQQIPPSKSAEAMRRVAKDLELQYKTKFLSMSRMFLSTCGLKSDLSTCLRSVMTLLVE
DGKLNWGRIVSLFAFTGVVAVEMSSRGDGVESCRKLAETIADYLVKEKSDWLLENGGWDGFCRFFSSTDHVSHDLSMKTV
LFAAAGVCLAGLTFLLMR
>gnl|bcl2dbpro|A0A2D0SDG7_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Ictalurus punctatus (length=258 residues).
MSMSMMKRTAPLSLLYCGVENGGGVSGVFRSRAPVQTFPQKREEELDGYTEEVDGRTVKTVINEIEVPLESRLLLQDSGC
DERIIPDLETETRALLMQLYRCHIGLHPGNNTHPALPSLQRVVGKLLCKHRITYSGMVQRLFDQANGLDSVSSVLSGVFS
GGVVSWGRIASVLALGAVVCERLKQECVKEQAEECVDVVTSHISSYLSKDLQHWFINNNSWNGFVEFFRVEDPEATVRNT
LMAVAGLGIGACLFTLMR
>gnl|bcl2dbpro|W5UHJ6_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Ictalurus punctatus (length=204 residues).
MANGNLYDNRRIVEKYLNHKLSKNGHAREFHRCRASSLDGQEEREKESSRRVTLHMALREAGDELESLYRPELAEMVKGL
RATSVGTEQPRFVAVADELFRDGVNWGRVVAFFEYGAMVCVQCAPETERNACAENVARWMAEYLNGPLNDWIQENGGWDA
FVELYTRKKDSVFSSSWPSLTTSVFSLAALGAVGLTIGAYLTQK
© 1998-2020Legal notice