Dataset for protein Bcl-xL of organism Ictalurus punctatus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|W5U9J4_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Ictalurus punctatus GN=BCL2L1 (length=242 residues).
MSYYNRELVVYFIKYKLSQRNYPCNHIGLTEDVNGTEGGQAEEASAEGAAELETPTAVVNGAVNGTGSAGTPPQSPTLSP
RRQVNGGASLEAVKEALRDSANEFELRYARAFSDLSSQLHITPVTVYQSFESVMDEVFRDGVNWGRIVGLFAFGGALCVE
CVEKEMSPLVARIAEWMTVYLDNHIQPWIQEQGGWERFAEIFGKDAAAESRRSQESFKKWLLAGMTLFTGVVLGSFIAQK
RL
© 1998-2020Legal notice