Dataset for protein Unclassified of organism Hucho hucho

[Download (right click)]

6 sequence(s)

>gnl|bcl2dbpro|A0A4W5L145_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Hucho hucho (length=165 residues).
MKISHQETCDALDTDTRQLMTCVLGQYTGLLKRGWNESKALSTMSRWSITGETQIHIQWFVSTLAHIIFRDGTVNWGRVA
SLTSFGAAVCQYLKDEGRDNCVELVGEEISAYLVTHHKDWLVKHNSWNGFVEFFSVAETESRSRNIIATLVGLAGIGAAM
TLLVM
>gnl|bcl2dbpro|A0A4W5L7M3_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Hucho hucho (length=192 residues).
MNNTHGVACVYKCQRCKGILSSCELETCDALDTDTRQLIKCVLGQYTGLLKRGWNESKALSTMSRVVGQLLEKHRYTYNG
RYCGMMFVSTLAHIIFRDGTVNWGHVASLTSFGAAVCQYLKDEGRDNCVELVGEEISAYLVTHHKDWLVKHNSWNGFVEF
FSVAEPESRSRNIIATLVGLAGIGAAMTLLVM
>gnl|bcl2dbpro|A0A4W5L9W4_uncBCL2L10-01 Putative BCL2-like 10 protein OS=[Eukaryota] Hucho hucho (length=196 residues).
MSCGLWKETLAIAEDYLSVCSIIPASGSRKAPPGPPPSDSAAAMRRQARDMEAKHRARFHALAHSFLCQCGPDPCASLRR
VMEELVGDGQMNWGRVVSLFTFTGVLVRELQGEDTDQALGNGMGLGGKESCRALAETIADYLGEEKSDWMLENKGWEGFC
KFFHTAREVNQDSSMKTALFAAAGVGIAGLTFLLVR
>gnl|bcl2dbpro|A0A4W5NU21_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Hucho hucho (length=255 residues).
MANDDNRFIVEKYICHKLLKMGYAWDFENAEDEEDADINVSMPGLARRCHGANNARPGSVPHVSKRLSQPDPHAAIHRVL
REAGDELERLYQTDFAEMSHQLYLTSSMAERRFKEVIDELFRDGVNWGRITAFFEFGGTICVECVNKEMTSQVDHIAGWM
TEYLNGPLHSWIQENGGWEAFVELYDRQRDSVFCSWPSIKTVFGLAALGAASLTIGAYLTQKTQGLTHPSQATAERGLNQ
PAKSPRTCPPAAAGL
>gnl|bcl2dbpro|A0A4W5NU21_uncBCL2-02 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Hucho hucho (length=228 residues).
MANDDNRFIVEKYICHKLLKMGYAWDFENAEDEEDADINVSMPGLARRCHGANNARPGSVPHVSKRLSQPDPHAAIHRVL
REAGDELERLYQTDFAEMSHQLYLTSSMAERRFKEVIDELFRDGVNWGRITAFFEFGGTICVECVNKEMTSQVDHIAGWM
TEYLNGPLHSWIQENGGWEGASNIPLESRLPLKVAGCATYQREAQRGERDLQDYRTTDYSQPVCIFNM
>gnl|bcl2dbpro|A0A4W5P0G2_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Hucho hucho (length=202 residues).
MANDNPYNSRVIVEKYIHHKLLKKGFDWEFNTENDSPNNGIGEIPQPDRHARLQRVLREAGDEIERMYQRDFAEMSGRLH
FTPSTAQRMFTAVIEELFSDGVNWGRIVAFFEFGGTMCVESVNREMTSQVDNIAHWMTEYLNGPLQNWIQENGDWVCLLI
NHSTFPSPTRTMIDLLSVSAVHISPGQYFSQSKETLPYPYSD
© 1998-2020Legal notice