Dataset for protein Bcl2l10 of organism Hucho hucho

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A4W5MLY7_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Hucho hucho GN=BCL2L10 (length=196 residues).
MSCGLWKETLAIAEDYLSVCSIIPASGSRKAPPGPPPSDSAAAMRCQARDMEAKHRARFHALAHSFLCQCGPNPCASLRR
VMEELVGDGQMNWGRVVSLFTFTGVLVRELQGEDTDQALGNGMGLGGKESCRALAETIADYLGEEKSDWMLENKGWEGFC
KFFHTAREVNQDSSMKTALFAAAGVGIAGLTFLLVR
© 1998-2020Legal notice