Dataset for protein Unclassified of organism Halichondria panicea

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A6C0SL63_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Halichondria panicea (length=280 residues).
MSKMNGANGHGPAKPKKSASQLQVHPTANGHGLQNGHIEQDTASIASPTPTSQATSSRDNGVFRQPRCVNGTSHLYRTPE
TVTVVKMLYCKLLSLAGVEKGDIKEFEVSDHSMKKLTNRKLVCKIVELSTEYIMTSEREFESFIDEFRTLGLDVTFSTMY
SEFRSVVESLFNDGINFGRVVSFLRFSAAYAVFVYRKGMKKAVPSVEAWTVEVIERDLGGFFAENKGWEGFAEYLETLLR
AHRRSLKPPADPPSMWETIYAFGAVAAGAATAYGLRQVFS
© 1998-2020Legal notice