Dataset for protein Mcl-1 of organism Gouania willdenowi

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8C5H9Y5_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Gouania willdenowi GN=MCL-1 (length=281 residues).
MNIVSTKSTSLMNCLLATQNGGVEGRINYQQKDPPRDHHAIDTSLDSLNGNIASSETPKRPKNLSVASTFVPKALREDSE
DMEDGSLPCTPEVHSDTEAEVSNCSGGAEVLENDTRQLMSRFLADYTGLSKRDWNESKALSTMKRVVEDVLEKHRYAYNG
MVNKLSLDNCSDDMTFVSAVAKSLFADQRTNWGRIASLVAFGAVVCQHLKERGRSNCVELVGQEISTYLLTEQREWLVKN
NSWDGFVDFFRVADPESTVRNTLMAFAGFAGIGATLAFLIR
>gnl|bcl2dbpro|A0A8C5H9Y5_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Gouania willdenowi GN=MCL-1 (length=327 residues).
MNIVSTKSTSLMNCLLATQNGGVEGRINYQQKDPPRDHHAIDTSLDSLNGNIASSETPKRPKNLSVASTFVPKALREDSE
DMEDGSLPCTPEVHSDTEAEVSNCSGGAEVLENDTRQLMSRFLADYTGLSKRDWNESKALSTMKRVVEDVLEKHRYAYNG
MVNKLSLDNCSDDMTFVSAVAKSLFADQRTNWGRIASLVAFGAVVCQHLKERGRSNCVELVGQEISTYLLTEQREWLVKN
NSWDGFVDFFRVADPESTVRNTLMAFAGFAGIGATLAFLIRRACGCLKNEKACKRGRRRHQRKGKSDPLFRQSEPRGSET
KETRSAM
© 1998-2022Legal notice