Dataset for protein Unclassified of organism Gorilla gorilla gorilla

[Download (right click)]

3 sequence(s)

>gnl|bcl2dbpro|A0A2I2ZAS6_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Gorilla gorilla gorilla (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A2I2ZAS6_uncBCL2L1-02 Putative BCL2-like 1 protein OS=[Eukaryota] Gorilla gorilla gorilla (length=145 residues).
MWKRTGLRPQKGLNRRWRPPVPSMATHPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAA
WMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|G3R922_uncBCL2A1-01 Putative BCL2-related protein A1 protein OS=[Eukaryota] Gorilla gorilla gorilla (length=79 residues).
MARSRLTATSVSQVQENGFVKKLEPKSGWMTFLEVTGKICEMLFCPEAILLTRKDTPYCETGLIFLTLMKTIANTYFYF
© 1998-2020Legal notice