Dataset for protein Bfl1 of organism Gopherus evgoodei

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C4W4P8_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Gopherus evgoodei GN=BCL2A1 (length=170 residues).
MESSEYCYVYYLVQDYLKYVLQEPQLGPAPSRVAHVLRHAASFLQKENEESLKPCLDTFDITSVDAARRIFTQVMDKEFA
DGNTNWGRILTIFMFGGILSKKLQEHRVQLTGENKKQISYFITEYIINTKAEWIEANGGWVSFSAVFYNHFSLLSRSEEF
SLINFFKMFF
© 1998-2022Legal notice