Dataset for protein Unclassified of organism Gadus morhua

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C5CAK2_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Gadus morhua (length=249 residues).
MTNTAEVYDSRDIVERFLHEKLEDKGITWEFHLPSQHSGRTLPSSPSSTTSAPSSSHAGSVNPRRRVSASSSGEEGGSPE
DSPVAWRPQYGAPSWGRRSRPRLQAVLQHRGSELRRIYQQDLSQVSAHLLRLSAGAARASLRAISGELFGNGVNWGRVLT
MLEFGATLCVDGALEGASWSADDVAAWLVESLDGPVLRDWIQDNGGWDAFVEQYDPARPPEGCWSVRKVVGLVVLGAAGI
TLGALFTQK
© 1998-2022Legal notice