Dataset for protein Unclassified of organism Fimbriaphyllia ancora

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A7D7PV32_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Fimbriaphyllia ancora (length=210 residues).
MAGATAALNNEDFSPTLITSEMSRYDKDIIEDAFTLTLDYISHRLRSKFEQTKLGGLPRRFLIPQTTNPSSSTLRKLGTL
MEAEHPDLFESLCTTLGITPVTAYPTFVGVAQEIFQAGTNWGRIVALFTFGGVVAHHFVETQRPEMVQHIVEWIVSFIAN
NLLTWIRENGGWDGFVAHFSESSQSQTMWKSLFTVGSICAAGLTLLALNK
© 1998-2021Legal notice