Dataset for protein Unclassified of organism Esox lucius

[Download (right click)]

4 sequence(s)

>gnl|bcl2dbpro|A0A3P8ZH18_uncBCL2L10-01 Putative BCL2-like 10 protein OS=[Eukaryota] Esox lucius (length=292 residues).
MPLMTAALLLPAVRRESSLIAGRIMSCGLWKETLAVAEDYLSVCRIVPTPGSPAATPPPPPSESAAAMRHLALDMEAQHR
ARFHALAHSFLSQCGLDPCASLRRVMEELVGDGQMNWGRVVSLFTFTGVLVRKLQGEDTDQGTGVRGTEWLGGKESCRAL
AETIANYLGKEKSDWMLKNQGWEGFCKFFHSARVVNQDSSMKTALFAAAGVGIAGNLLRRPWVPVTVASGTFCLMADARS
WKRDRYPHPPLRPQQTHTQCYTGCRYVCKINNFALDYSISYILYVHAFIYFF
>gnl|bcl2dbpro|A0A3P8ZH18_uncBCL2L10-02 Putative BCL2-like 10 protein OS=[Eukaryota] Esox lucius (length=222 residues).
MPLMTAALLLPAVRRESSLIAGRIMSCGLWKETLAVAEDYLSVCRIVPTPGSPAATPPPPPSESAAAMRHLALDMEAQHR
ARFHALAHSFLSQCGLDPCASLRRVMEELVGDGQMNWGRVVSLFTFTGVLVRKLQGEDTDQGTGVRGTEWLGGKESCRAL
AETIANYLGKEKSDWMLKNQGWEGFCKFFHSARVVNQDSSMKTALFAAAGVGIAGLTFLLVR
>gnl|bcl2dbpro|A0A3P9AAB2_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Esox lucius (length=206 residues).
MANENPYDSRVIVENYIYDKLLKNGFVWEFQTENQSRNNVFEDPSPPNSPELFARRLQPPAAGEDNDPQFANRIPQPDPH
ARLHRVLRDAGNEIERMYQRDFAEMSGQLHITPSTAHGRFTAVIDELFSDGVNWGRIVAFLEFGGTMCVESVNREMTPQV
NNIVHWMTEYLNGPLQNWIQENGGWLCCTNASHTLILQWASETDTG
>gnl|bcl2dbpro|A0A6Q2WT30_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Esox lucius (length=155 residues).
MANENPYDSRVIVENYIYDKTVKNGFVWEFQTENQSRNNETNLSSQIDPATDPHARLHRVLRDAGNEIEECISGTCRDVG
AVAYYAQHGTWTIYRIIDELFSDGVNWGRIVASLSWRDNTEYLNGPLQNWIQENGGWVRLLSTLLTKLGFIAFCQ
© 1998-2022Legal notice