Dataset for protein Unclassified of organism Erpetoichthys calabaricus

[Download (right click)]

4 sequence(s)

>gnl|bcl2dbpro|A0A8C4RXD1_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Erpetoichthys calabaricus (length=234 residues).
MASNRVPYDNWNIVSFYIRERLLRMGYEWEAHVLRERDSPNNGSLGSSHSPQQPPRRAGVLQIRPGDPHTAIHGVLRDAG
DEISRRYQRDFAEMSGQLHLTPSTARRKFAAVAEELFRDGVNWGRIVAFFEFGGTMCVESVNREMTSQVDHIADWMTDYL
NGPLHNWIQDNGGWFPADRSQEIPPGAEAQKKTLPVPSPRATSLPSTLHKSCSPSCGDQFCLGLSSINYPVLTF
>gnl|bcl2dbpro|A0A8C4SVH9_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Erpetoichthys calabaricus (length=251 residues).
MSYFSKSTQTMSRRLEDGKFDDNLEEADSVSQLQKLSSKNCLELGEGANVDSCRPSTRDATSRPVDSVQCGPRPVPRLEK
ETRELIAAYLFRSAGLPHSCSRSGRKPYDILVLAGDRIIENNKSWFNELLESIDVSQKELPEYVTTLAQVTLTGREMKWR
YVLGFIIHGSVVAKRLKQVNQEHCILPLADLMSALLLKHCKDWIVKNRAWEGFSDYYHFLVREPETWQFPLTCLGLSFLA
ALLVCLFEELM
>gnl|bcl2dbpro|A0A8C4SXC2_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Erpetoichthys calabaricus (length=250 residues).
MSYFSKSTQTMSRRLEDGKFDDNLEEADSVSQLQKLSSKNCLELGEGANVDSCRPSTRDATSRPVDSVQYGPRPVSRLEK
ETRELIAAYLFRSAGLPHSCSRSGRKPFDILVRAEDRLIETNRSWFNEAVQTIDVSQKEVLENTTGVAQAMLTQKVMKWR
YVLSFMMYGSVVAKHLKEVNQEHCILPLADLMSALLLKHCKDWIVKNRAWEGFSDYYHFLVRDQETWQFPLTCLGLSFLA
ALLVCLFELM
>gnl|bcl2dbpro|A0A8C4T7P8_uncBCL2A1-01 Putative BCL2-related protein A1 protein OS=[Eukaryota] Erpetoichthys calabaricus (length=175 residues).
MPCYRKETYEVAKGYIDHCIGVQRAPPSETVQIMCSLAKEMEKTYQHKLNSLLQNFISCCTPDYGVKLKRVMEEMVGDGI
LNWGRIVSLFTFTGLLAQELHSKGAGTDCSNKLADTIADYLGVEKAEWLAQNGGWDGFSKYFQNSKDSHSDSSMKTALFA
AAGFGIAGLAILLVR
© 1998-2022Legal notice