Dataset for protein Mcl-1 of organism Erpetoichthys calabaricus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C4RFB4_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Erpetoichthys calabaricus GN=MCL-1 (length=295 residues).
MNPALATMNRSPATSLVQMLYCSGPSGLNGVFKHDALHLAKGADFTGSTQMMSVQLDEGELDDCLDEVDSVSQLHKSSSK
NCLKNLLFSAESSNADGSLPASPETPSSPMDSSQPGFTPAADAQLAQETEELIAAYLFRSAGLPCSRIRNGNKSFDTLVR
VGDSVIEKHKFAFNGMLRKLNISQEGDMGFMTPVAESIFSDGVINWGRVVSLVAFGAVVAKHLKQVNLERCIRPLADQIS
TFLLTRQKDWIVNNRAWEGFVEFFRIEDPEAGIRQALITFAGMAGIGAGIAYLIR
© 1998-2022Legal notice