Dataset for protein Unclassified of organism Eptatretus burgeri

[Download (right click)]

4 sequence(s)

>gnl|bcl2dbpro|A0A8C4NG87_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Eptatretus burgeri (length=141 residues).
MGRPHTVPCGCSRLIGISRRWGWARHLPVGWPGLPGECADSCFVEGINWDRMVTFFLFGVALHTELAAIAHVDSLSSRRS
DEMENKLHPWIIANGGWFPPSFTGELFSLLLVLYCSWGEANEAVLHMGFTWLKLGRRRLLS
>gnl|bcl2dbpro|A0A8C4QUZ0_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Eptatretus burgeri (length=205 residues).
MAEAGEAFLRVANRDVDEFTTRSRDVLASALGVDWAPGPLAQPIRDENLVRSLRTHIDFVLSRYGDHLEALADRLDDGST
SHITAEWAEGMAHQLANAVFQDDVTNWGRVLTLVAFAKVLGRRLAARGAPRSACALLDGVVGYLARSKRSWILDNGGWYG
LCLMVCFIRVLFQGTSMQEEGIRHIKACAMVANLWLFVHGLLFKF
>gnl|bcl2dbpro|A0A8C4R0S3_uncBCL2A1-01 Putative BCL2-related protein A1 protein OS=[Eukaryota] Eptatretus burgeri (length=189 residues).
MEDDLLMKETTALIKAYVMHRVAPDVPQPLNQAESVLIRLGDEVFSQHRETFREMLGRLYPNPHDLSNASSVAGTATRVA
EEVFSDEEVNWGRLAAVIVLLATVAQEMDDRFGTVDERSEVLSLEMSRFVVENHGDWIRERGGWEDFVRRYKRRSLPSLR
TRWVCAAVLCGIMASIVWFVRYHIFQNHD
>gnl|bcl2dbpro|A0A8C4WY70_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Eptatretus burgeri (length=158 residues).
MEETHRHTHTHTHTHTHTHARTLKHTHTRYPFSRHSVEFSRFKQNLRSETCCIAGAEATLEAVAAEVFSDGINWGRIVSL
FAFSAEIAQTRCAAGEDQETTVAVLSAVATRGIIEHAGNFMTNNGGWVIQYKAGWLCTHSACRTGRRENFLKYRNFGS
© 1998-2023Legal notice