Dataset for protein Mcl-1 of organism Dromaius novaehollandiae

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C4K2K9_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Dromaius novaehollandiae GN=MCL-1 (length=178 residues).
PVGRPLGGVCGPGLCGALEVGGHRLCPAAAGSSGGWGRPGPPPALGAGARLQIASPAGMLRKLDIQKEEDLQSVCEVAAH
VFSDGVTNWGRVVTLISFGAFVAKHLKSINQEKCISSLAGIITDALVSSKREWLVSQGGWEGFVDFFRVEDLEGSIRNVL
MAFAGVAGLGASLAYMIR
© 1998-2022Legal notice