Dataset for protein Unclassified of organism Dicentrarchus labrax

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8P4GM38_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Dicentrarchus labrax (length=235 residues).
MSSASSSRDIVEDFLRYKLLSTGLTWRDPPRRRRTGGQRRHNAAASAASAASALTASSGRPERAVTSHRGVAVEDSQQGP
SSSPTRLQVALRCAGDELEQRYRGDLAAQVSVLLLCDGGVAELLRGLTAVREELFRDGVNWGRIVAMMALGGALSAEVAH
TDGAWRVDDIAAWLEESLDSQPLRGWIEDNGGWDAFTELYGDSRPRARFWSLATVFGLAVLGAAGITLGALFIRR
© 1998-2023Legal notice