Dataset for protein Unclassified of organism Denticeps clupeoides

[Download (right click)]

4 sequence(s)

>gnl|bcl2dbpro|A0A8C3ZRU8_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Denticeps clupeoides (length=123 residues).
RTAAMASDVPHDSRAIELFRDGVNWGRVVAFFEFGGAVCVESVGRQASPQVENVTQWMTEYLDGPLRVWIEDNGGWVRCA
TSSSHLDRCPPGDTEVLLPGRLSWCPLTHFTVCTVCCAAEYHM
>gnl|bcl2dbpro|A0A8C4B0G6_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Denticeps clupeoides (length=184 residues).
MAHDNRSIVEKYLRHKLVKRGLAWEGPRSPGPPDAPLDRVLREAGDELERLYQPDFVEMSRQLQLTAVAAERRFTAVMDE
LFRDGVNWGRIIAFFEFGGTVCVECVNREMTAQVDNIAGWMTEYLDGPLQAWIQENGGWEAFVELYGQQQSSAFRSSWSS
IASVFGLAALGAVGLTIGAYLAQK
>gnl|bcl2dbpro|A0A8C4B5U0_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Denticeps clupeoides (length=244 residues).
MSQSPAASFFISNGVVDKGILRCEPTMDLSNYPAPLTQDFCPGAGKTGKCCLLRPNNLVRHGFQNSFTGSDVTDGSLPSS
PEEAEPSTFPSPDALENDTRDLIERAALKTIDLFYNVTFASAGMINKLKVEEQPGDLTVVSSIAKELFSDGKTNWGRIAS
LVAFGALLSKHLREKGHGDSVSLVAHEISSYLLSDQLNWLIKNNKWEGFVQFFHIEDPETTVRTALMKIVGVVGIGAGLA
FLLK
>gnl|bcl2dbpro|A0A8C4FRZ1_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Denticeps clupeoides (length=184 residues).
MASDVPHDSRAIVESYVYHRLLQKGHAWDRGAPPRRDEARGRLQRALRRAGDELERMFRRDLASVGRRLRLSRGTFSAVV
EELFRDGVNWGRVVAFFEFGGAVCVESVGRQASPQVENVTQWMTEYLDGPLRVWIEDNGGWDAFVELYGQQEDSVLSWTY
LKTMFGLAALGVAGVTLGAFFIQK
© 1998-2022Legal notice