Dataset for protein Mcl-1 of organism Delphinapterus leucas

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A2Y9MRT2_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Delphinapterus leucas GN=MCL-1 (length=351 residues).
MFGLKRNAVIGLNLYCGGAGLGPDSGSGASAPGRRLLAAGKEATAGREVGGGEAGEVIGGSAGPSPPATLAPDARRVARP
SPIGAEGPDVTATPARLLFFAPTRRASPPEEMESSVSDAIMSPEEELDGCEPEPLGKRPSVLPLLELVGEASNSPGKDGS
LPSTPPPAEEEEDELYRQSLEIISRYLREQATGTKDAKPLGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKN
EDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVDFF
HVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
© 1998-2020Legal notice