Dataset for protein Mcl-1 of organism Coregonus sp balchen

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A6F9BEN5_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Coregonus sp. 'balchen' GN=MCL-1 (length=292 residues).
MNLSKSFTRATTTMLNIQNGVVGGSSYPAGASPLYYFGANGAVCAGASPKSKVDTDLGNGTGDTPPRPTKLAVNVVKSNV
LDNHLSDRSNNDDSDDSLPCTPQMASECGPDISNCPSGDEVLEHDTRQLIENVLGDYTGLSPSRWKQSKTLTTMKRVVED
VIAKHRYAYNGMIDKLDLDDRSDDMSVIKSVAKTLFSDGITNWGRIASLVAFGAVVSQHLKERGRGHCVELVGQEIATYL
LSDQRDWLVKNNAWNGFVEFFHVQDPESSVRNTLIAFAGVAGIGATLAMLIR
© 1998-2020Legal notice