Dataset for protein Unclassified of organism Clytia hemisphaerica

[Download (right click)]

9 sequence(s)

>gnl|bcl2dbpro|A0A7M5VAR7_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Clytia hemisphaerica (length=231 residues).
MMLRLICLTWCLVLTSGKPATKYHQEDLLDMVKRALEGGLHQSLDVAKQLVSSDLDALEGDIKKNGFKSGNVMKTPNAVQ
IKKNLHSDIKVGKYEQKIFKSVKAAVCSKGEGHLEEAVDSFMDFLATIRNNILTKAAGKYLDSVEDFVGTTSIDFDDEER
KIVKEMDLDGDVTIENFHDEIKNAVAICKKDYVGCKDDDSDVGEYVDVKDQVDDIIDTLQKKLENVRKAAS
>gnl|bcl2dbpro|A0A7M5VAR7_uncBCL2L1-02 Putative BCL2-like 1 protein OS=[Eukaryota] Clytia hemisphaerica (length=196 residues).
MAGAQPPNENEEEKIRRLIQDFVGERLRRKGISVPGYDQEELINENSSISEIALTLRRVGDEFEMAADTQFVANMCTRLS
ITPNTAYPMFQAISDKIFASGKNWGRVVAFLTFGSSLAVHCAEKPDMGVTFVDTIVSWIHQYVVSRLGEWIKEQGGLKGF
MDFFKRDQAQNTTQNGFLMSALAGVGLGAFLMMTFK
>gnl|bcl2dbpro|A0A7M5VGN0_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Clytia hemisphaerica (length=277 residues).
MSNIEENESLNGAEEMVATKKSQTTLWIYLYRCSKLGPRSLWIKQSNCVLEELTRTICDKAIRHRMTKASIDHSPIKSPK
LYETPSEKTMQCVKDMIDLIVSSHPELYTEITFKLNIPVQDERTVCRTYSEFAENLFKRGVSWPLIISLLSFSGSLAAEC
TRNGRSILVRRICDWATLFIVMRLKDWIQDNGGWDGMYEFFYQPTLNNNSVFPSDKLQQLNEWKIAISNAVKPEKAARFA
LGFFIFLALLLITFFKSTSTECKSGGVRSKFSIYRDC
>gnl|bcl2dbpro|A0A7M5VGN0_uncBCL2L1-02 Putative BCL2-like 1 protein OS=[Eukaryota] Clytia hemisphaerica (length=300 residues).
MLRSFEQIRNTRKIGSLDIKDVHSSNSDEDDLGSGAEEMVATKKSQTTLWIYLYRCSKLGPRSLWIKQSNCVLEELTRTI
CDKAIRHRMTKASIDHSPIKSPKLYETPSEKTMQCVKDMIDLIVSSHPELYTEITFKLNIPVQDERTVCRTYSEFAENLF
KRGVSWPLIISLLSFSGSLAAECTRNGRSILVRRICDWATLFIVMRLKDWIQDNGGWDGMYEFFYQPTLNNNSVFPSDKL
QQLNEWKIAISNAVKPEKAARFALGFFIFLALLLITFFKSTSTECKSGGVRSKFSIYRDC
>gnl|bcl2dbpro|A0A7M5WJ94_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Clytia hemisphaerica (length=278 residues).
MPLTIEDEGAPLTPPTSITPEPPSPSPSIRERRLQDRNNKEFIRRLANDYIHFKIHGPNSHTQDMEVFQDSNQSLLSPRS
PRVNRFQSTSTGAYSERSSVSDSNNNMVHSPTLSEPSDDVIDDQISNQEPFRKASRVLRKVSVELERSNSAFFENVCEDL
SLNNTDARTAFRNVSDRVLDRDSLNWGRVVSVFTFGGKLAEWFWNSHQEERIDEVEEWLAESLSSKESWIEENGGWEYFA
EKFEKDREKDDTNFNWLKPGLLMCVGVSLAAIFSMKMQ
>gnl|bcl2dbpro|A0A7M5WRB5_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Clytia hemisphaerica (length=228 residues).
MAPNMSPITIRNTNAKQLCNQKDKIEPPIEIQIEHEIDTKLLSIINNGYNIAKYYIPYHLRCSCKHELLQGLPKSFVVPP
AQPPELYLRVATFSYGMEKKFEAFFEQIPTHMKLKNENAKEIFISLCRRVVSSDVNWGRVISIFTVGGAFAVHFVNKGQL
DIVKSIPGWVQEVLETTEGLPEWIQEQGGWEKLSLRSKDDLNNASWSSYVTVGFGVAAAGMLLFGLSK
>gnl|bcl2dbpro|A0A7M5WRB5_uncBCL2L1-02 Putative BCL2-like 1 protein OS=[Eukaryota] Clytia hemisphaerica (length=228 residues).
MAPNMSPITIRNTNAKQLCNQKDKIEPPIEIQIEHEIDTKLLSIINNGYNIAKYYIPYHLRCSCKHELLQGLPKSFVVPP
AQPPELYLRVATFSYGMEKKFEAFFEQIPTHMKLKNENAKEIFISLCRRVVSSDVNWGRVISIFTVGGAFAVHFVNKGQL
DIVKSIPGWVQEVLETTEGLPEWIQEQGGWEKLSLRSKDDLNNASWSSYVTVGFGVAAAGMLLFGLSK
>gnl|bcl2dbpro|A0A7M5WUV8_uncBCL2L1-02 Putative BCL2-like 1 protein OS=[Eukaryota] Clytia hemisphaerica (length=246 residues).
MLRSFEQIRNTRKIGSLDIKDVHSSNSDEDDLGSGAEEMVATKKSQTTLWIYLYRCSKLGPRSLWIKQSNCVLEELTRTI
CDKAIRHRMTKASIDHSPIKSPKLYETPSEKTMQCVKDMIDLIVSSHPELYTEITFKLNIPVQDERTVCRTYSEFAENLF
KRGVSWPLIISLLSFSGSLAAECTRNGRSILVRRICDWATLFIVMRLKDWIQDNGGWDGMYEFFYQPTLNNNSVFPSDKL
QTPTIK
>gnl|bcl2dbpro|A0A7M5WUV8_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Clytia hemisphaerica (length=223 residues).
MSNIEENESLNGAEEMVATKKSQTTLWIYLYRCSKLGPRSLWIKQSNCVLEELTRTICDKAIRHRMTKASIDHSPIKSPK
LYETPSEKTMQCVKDMIDLIVSSHPELYTEITFKLNIPVQDERTVCRTYSEFAENLFKRGVSWPLIISLLSFSGSLAAEC
TRNGRSILVRRICDWATLFIVMRLKDWIQDNGGWDGMYEFFYQPTLNNNSVFPSDKLQTPTIK
© 1998-2022Legal notice