Dataset for protein Bcl-2 of organism Chrysemys picta bellii

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C3ITE1_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Chrysemys picta bellii GN=BCL-2 (length=252 residues).
MYLIACVCTLHWREKHSTSARAWSQRGYDNREIVLKYIHYKLSQRGYDWAANENRGPVSPNLSPPTVAGTSSDHAGLVSL
PPEPPGSAAASNVPLGDGLRPAPQAVLLTLCQAGDEFSRRYHRDFAQMSGQLHLTPFTARGRFVAVVEELFRDGVNWGRI
VAFFEFGGVMCVESVNREMSPLVDSIAVWMTEYLNRHLHNWIQDNGGWDAFVELYGNNMRPLFDFSWISLKTILSLALVG
ACITLGAYLGHK
© 1998-2022Legal notice