Dataset for protein BCL-2-like of organism Chloebia gouldiae

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3L8SK92_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Chloebia gouldiae GN=BCL2A1 (length=174 residues).
METAEFYYVYYLAQDYLQYVLQESHLGPAQTRVAHVLRTTASSLQDQTEEAVRPLLDRIDITSVAVAKRIFNGVMDEKFA
DGNTNWGRIMTIFTFGGLLTKKLREHGVQLTAEEKEEISYFITEYIINNKAEWIDANGGWENGFLTKFERRSLLSFSKIT
ALFIALVSLFREYY
© 1998-2020Legal notice