Dataset for protein Bcl-2 of organism Chinchilla lanigera

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C2VKS3_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Chinchilla lanigera GN=BCL-2 (length=239 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGEESAAPPGAAPTPGIFSFQPGRNSPAAAPRDPAARTSPPPPLAGLAA
AAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVE
SVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSVRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
© 1998-2022Legal notice