Dataset for protein Bcl-xL of organism Catharus ustulatus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8C3U3Q2_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Catharus ustulatus GN=BCL2L1 (length=231 residues).
MYSSNRALVIDFVSYKLSQKGYSWSQLEEEDENRTDFAGEEDEMDGVLNGSPSWHAPTSHIVNGASVHQSSLEAHEIRRA
PDDVRQALREAGDEFELRYRRAFSDLTSQLHITPSTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVVKEMRVL
VKRIVSWMTTYLTDHLDPWIQENGGWERFVDLYGNDAAAEVRKGQETFNKWLLTGATVAGVLLLGSLLSRK
© 1998-2023Legal notice