Dataset for protein Unclassified of organism Callorhinchus milii

[Download (right click)]

5 sequence(s)

>gnl|bcl2dbpro|A0A4W3H280_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Callorhinchus milii (length=121 residues).
GIVNRLNISDRGDLNAIEKVGTEMFSDGEMNWGRVVSFIAFGAVMGERLADMQMQDLIDLVAEEITQYLTQQKREWLQKH
NGWDGFTEFFEENDLEDSTKKVLMVVASVGLAGAGILHWLR
>gnl|bcl2dbpro|A0A4W3H3E3_uncMCL1-01 Putative Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Callorhinchus milii (length=133 residues).
MRTVSVVVAGVGISNTSHSKKQNYLLVTMSIFSIGIVNHLNISGKRDLNAIKKVGTEMFSDGEMNWGRVVSFIAFGAVMG
EHLAKLQLDDLIDLMAEEITQYLTQQKREWLQKHNGWVRRSFGKPFDQENQCT
>gnl|bcl2dbpro|A0A4W3HHG3_uncBCL2-01 Putative B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Callorhinchus milii (length=229 residues).
MYTETMSYESRELVFHYLYYRVSRHGYVWEEALGSAADSPHTSTPPAPAPAPAPASAALEKLHRVLREVGDSFERQYQQE
FADIALQMRFEPDGARSRFDAVAEELFRDGINWGRIVAFFVFGGTLCVESCKRRDMAPLVDSIAAWMTAYLDSSLANWIS
ANGDWVCAGHPLPECVQGTHCPSVCRAPTARVCGCRVPIALCVCVGYPLPCVCVCMYRVPIALCVCVCV
>gnl|bcl2dbpro|A0A4W3JU32_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Callorhinchus milii (length=197 residues).
MALSSRALVEDFLGYKLRQRGHCWPPSEAQAQAAGPGSAGPEEEEEAERVRVALREAAEEFELRYRRAFRGLAAQLHVTP
DTAYQRFEQVVGELFRDGVNWGRIVAFFCFGGALSAESLDKEMAPLVPRIASWMIIYMESNLQPWILQHGGWEAFVALYG
NNAAARSRHIQETVTWLMTLVAVGAGLAIAVFLARRR
>gnl|bcl2dbpro|A0A4W3JUE6_uncBCL2A1-01 Putative BCL2-related protein A1 protein OS=[Eukaryota] Callorhinchus milii (length=221 residues).
MRQCVREEARQLAGDYLDHCLYPGRQARPPSRTAETLRKVTDQMVEQHQAAFSSMKSRFDNGLRFSSKPAASEAAAAAAP
AAPAAATVVAGEAAAEATRAAVAAGDFLRRVVEEMSADEKMNWGRVVSVFAFAGVLSRHLRDSGIVMCPATGPSPLDSLA
DSVANYLGKEKREWIEQNGGWEGFLRFFGSNDHWQESTVRNMLITVAGFGIAGIACLLAVR
© 1998-2020Legal notice